PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc003587.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 293aa    MW: 34194.2 Da    PI: 4.7293
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc003587.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.53e-54521791128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lppGfrFhPtdeelv++yLk+k++g ++el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk
  Itr_sc003587.1_g00001.1  52 LPPGFRFHPTDEELVNYYLKRKIHGLEIEL-DIIPEVDLYKCEPWELAeKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWK 136
                              79****************************.99**************84335556888**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              +tgkd++v s +++++g+kktLv+y+grap+g +tdWvmheyrl
  Itr_sc003587.1_g00001.1 137 STGKDRRVSS-QNRAIGMKKTLVYYRGRAPQGIRTDWVMHEYRL 179
                              *********9.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-6247204IPR003441NAC domain
PROSITE profilePS5100559.78352204IPR003441NAC domain
PfamPF023651.0E-2953179IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MIAEIKGCYS ERERERKRWW GGGPAVYFAA GWPGRREIER EKERERMAPV GLPPGFRFHP  60
TDEELVNYYL KRKIHGLEIE LDIIPEVDLY KCEPWELAEK SFLPSRDPEW YFFGPRDRKY  120
PNGFRTNRAT RAGYWKSTGK DRRVSSQNRA IGMKKTLVYY RGRAPQGIRT DWVMHEYRLD  180
DKECDDSSAG IQVDSYALCR VFKKNGICSE IEEQATQPSC NIQILDYSSA QTVANDQYET  240
PSPEVPFTSS SCVEEEEKED KDDSWMQFIT EDAWCSFTSP YATEECTDDI LDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-56422045168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00363DAPTransfer from AT3G17730Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016567704.11e-142PREDICTED: NAC domain-containing protein 86 isoform X1
SwissprotQ9FFI54e-90NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A068TRH51e-139A0A068TRH5_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000797491e-137(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46212442
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-121NAC domain containing protein 57